Protein Info for ECD_01606 in Escherichia coli BL21

Annotation: pyridoxamine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00687: pyridoxal kinase
  • amino acids 1 to 286 (286 residues), 484.8 bits, E=4.5e-150
• PF08543: Phos_pyr_kin
  • amino acids 72 to 257 (186 residues), 58.3 bits, E=8.1e-20
• PF00294: PfkB
  • amino acids 132 to 249 (118 residues), 39.9 bits, E=3.4e-14

Best Hits

Swiss-Prot: 100% identical to PDXY_ECOLI: Pyridoxal kinase PdxY (pdxY) from Escherichia coli (strain K12)

KEGG orthology group: K00868, pyridoxine kinase [EC: 2.7.1.35] (inferred from 100% identity to eco:b1636)

MetaCyc: 100% identical to pyridoxal kinase 2 (Escherichia coli K-12 substr. MG1655)
Pyridoxal kinase. [EC: 2.7.1.35]

Predicted SEED Role

"Pyridoxal kinase (EC 2.7.1.35)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.7.1.35)

MetaCyc Pathways

• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• pyridoxal 5'-phosphate salvage I (5/6 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (7/9 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (4/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.35

Use Curated BLAST to search for 2.7.1.35

Protein Sequence (287 amino acids)

>ECD_01606 pyridoxamine kinase (Escherichia coli BL21)
MMKNILAIQSHVVYGHAGNSAAEFPMRRLGANVWPLNTVQFSNHTQYGKWTGCVMPPSHL
TEIVQGIAAIDKLHTCDAVLSGYLGSAEQGEHILGIVRQVKAANPQAKYFCDPVMGHPEK
GCIVAPGVAEFHVRHGLPASDIIAPNLVELEILCEHAVNNVEEAVLAARELIAQGPQIVL
VKHLARAGYSRDRFEMLLVTADEAWHISRPLVDFGMRQPVGVGDVTSGLLLVKLLQGATL
QEALEHVTAAVYEIMVTTKAMQEYELQVVAAQDRIAKPEHYFSATKL