Protein Info for ECD_01602 in Escherichia coli BL21

Annotation: SoxR iron-sulfur cluster reduction factor component; electron transport inner membrane NADH-quinone reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 19 to 32 (14 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 183 to 206 (24 residues), see Phobius details PF02508: Rnf-Nqr" amino acids 6 to 199 (194 residues), 209 bits, see alignment E=2.7e-66 TIGR01948: electron transport complex, RnfABCDGE type, E subunit" amino acids 7 to 208 (202 residues), 269 bits, see alignment E=1.1e-84

Best Hits

Swiss-Prot: 100% identical to RSXE_ECOHS: Ion-translocating oxidoreductase complex subunit E (rsxE) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: K03613, electron transport complex protein RnfE (inferred from 100% identity to eco:b1632)

Predicted SEED Role

"Electron transport complex protein RnfE" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>ECD_01602 SoxR iron-sulfur cluster reduction factor component; electron transport inner membrane NADH-quinone reductase (Escherichia coli BL21)
MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR
HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA
KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD
SPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRAEAAAERALPNGETGNV