Protein Info for ECD_01552 in Escherichia coli BL21

Annotation: UPF0482 family putative periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF06932: DUF1283" amino acids 32 to 113 (82 residues), 152.8 bits, see alignment E=1.1e-49

Best Hits

Swiss-Prot: 100% identical to YNFB_ECO8A: UPF0482 protein YnfB (ynfB) from Escherichia coli O8 (strain IAI1)

KEGG orthology group: None (inferred from 100% identity to eco:b1583)

Predicted SEED Role

"putative secreted protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (113 amino acids)

>ECD_01552 UPF0482 family putative periplasmic protein (Escherichia coli BL21)
MKITLSKRIGLLAILLPCALALSTTVHAETNKLVIESGDSAQSRQHAAMEKEQWNDTRNL
RQKVNKRTEKEWDKADAAFDNRDKCEQSANINAYWEPNTLRCLDRRTGRVITP