Protein Info for ECD_01490 in Escherichia coli BL21

Annotation: multiple antibiotic resistance transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 PF00165: HTH_AraC" amino acids 18 to 59 (42 residues), 27.4 bits, see alignment E=2.8e-10 PF12833: HTH_18" amino acids 32 to 108 (77 residues), 69.2 bits, see alignment E=3.2e-23

Best Hits

Swiss-Prot: 100% identical to MARA_SHIFL: Multiple antibiotic resistance protein MarA (marA) from Shigella flexneri

KEGG orthology group: K13632, AraC family transcriptional regulator, multiple antibiotic resistance protein MarA (inferred from 100% identity to eco:b1531)

Predicted SEED Role

"Multiple antibiotic resistance protein MarA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (127 amino acids)

>ECD_01490 multiple antibiotic resistance transcriptional regulator (Escherichia coli BL21)
MSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRS
RKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLH
PLNHYNS