Protein Info for ECD_01475 in Escherichia coli BL21

Annotation: autoinducer-2 (AI-2) degrading protein LsrG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03992: ABM
  • amino acids 1 to 76 (76 residues), 73.3 bits, E=7.2e-25

Best Hits

Swiss-Prot: 100% identical to LSRG_ECODH: (4S)-4-hydroxy-5-phosphonooxypentane-2,3-dione isomerase (lsrG) from Escherichia coli (strain K12 / DH10B)

KEGG orthology group: K11530, autoinducer 2-degrading protein (inferred from 100% identity to eco:b1518)

MetaCyc: 100% identical to (4S)-4-hydroxy-5-phosphonooxypentane-2,3-dione isomerase (Escherichia coli K-12 substr. MG1655)
RXN-15216 [EC: 5.3.1.32]; RXN0-6720 [EC: 5.3.1.32]

Predicted SEED Role

"Autoinducer 2 (AI-2) modifying protein LsrG" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon)

MetaCyc Pathways

• autoinducer AI-2 degradation (2/3 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.32

Protein Sequence (96 amino acids)

>ECD_01475 autoinducer-2 (AI-2) degrading protein LsrG (Escherichia coli BL21)
MHVTLVEINVHEDKVDEFIEVFRQNHLGSVQEEGNLRFDVLQDPEVNSRFYIYEAYKDED
AVAFHKTTPHYKTCVAKLESLMTGPRKKRLFNGLMP