Protein Info for ECD_01455 in Escherichia coli BL21

Annotation: putative YdeN-specific sulfatase-maturating enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 TIGR03942: anaerobic sulfatase maturase" amino acids 2 to 364 (363 residues), 505.3 bits, see alignment E=9.8e-156 PF13353: Fer4_12" amino acids 11 to 122 (112 residues), 24.9 bits, see alignment E=4.7e-09 PF04055: Radical_SAM" amino acids 11 to 175 (165 residues), 81.4 bits, see alignment E=1.8e-26 PF13186: SPASM" amino acids 263 to 318 (56 residues), 28.3 bits, see alignment 3.5e-10 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 265 to 345 (81 residues), 66.1 bits, see alignment E=3e-22

Best Hits

Swiss-Prot: 100% identical to YDEM_ECOLI: Anaerobic sulfatase-maturating enzyme homolog YdeM (ydeM) from Escherichia coli (strain K12)

KEGG orthology group: K06871, (no description) (inferred from 100% identity to eco:b1497)

Predicted SEED Role

"GALNS arylsulfatase regulator (Fe-S oxidoreductase)" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>ECD_01455 putative YdeN-specific sulfatase-maturating enzyme (Escherichia coli BL21)
MHVTAKPSSFQCNLKCDYCFYLEKESQFTHEKWMDDSTLKEFIKQYIAASGNQVYFTWQG
GEPTLAGLDFFRKVIHYQQRYAGQKRIFNALQTNGILLNNEWCAFLKEHEFLVGISIDGP
QELHDRYRRSNSGNGTFAKVIAAIERLKSYQVEFNTLTVINNVNVHYPLEVYHFLKSIGS
KHMQFIELLETGTPNIDFSGHSENTFRIIDFSVPPTAYGKFMSTIFMQWVKNDVGEIFIR
QFESFVSRFLGNGHTSCIFQESCKDNLVVESNGDIYECDHFVYPQYKIGNINKSELKTMN
SVQLTAQKKRIPAKCQQCAYKPICNGGCPKHRITKVNNETVSYFCEGYKILFSTMVPYMN
AMVELAKNRVPLYHIMDVAKQMENN