Protein Info for ECD_01437 in Escherichia coli BL21
Annotation: malate dehydrogenase, decarboxylating, NAD-requiring; malic enzyme
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to MAO1_ECOLI: NAD-dependent malic enzyme (maeA) from Escherichia coli (strain K12)
KEGG orthology group: K00027, malate dehydrogenase (oxaloacetate-decarboxylating) [EC: 1.1.1.38] (inferred from 100% identity to eco:b1479)MetaCyc: 100% identical to malate dehydrogenase (oxaloacetate-decarboxylating) (Escherichia coli K-12 substr. MG1655)
Malate dehydrogenase (oxaloacetate-decarboxylating). [EC: 1.1.1.38]
Predicted SEED Role
"NAD-dependent malic enzyme (EC 1.1.1.38)" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP (EC 1.1.1.38)
MetaCyc Pathways
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
- mixed acid fermentation (16/16 steps found)
- gluconeogenesis I (13/13 steps found)
- superpathway of glyoxylate bypass and TCA (11/12 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
- TCA cycle I (prokaryotic) (9/10 steps found)
- glyoxylate cycle (6/6 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
- TCA cycle III (animals) (8/10 steps found)
- TCA cycle VIII (Chlamydia) (5/6 steps found)
- (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
- malate/L-aspartate shuttle pathway (2/2 steps found)
- TCA cycle II (plants and fungi) (7/9 steps found)
- TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
- TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
- gluconeogenesis III (9/12 steps found)
- L-malate degradation II (1/1 steps found)
- chitin deacetylation (3/4 steps found)
- C4 photosynthetic carbon assimilation cycle, NAD-ME type (8/11 steps found)
- reductive TCA cycle I (8/11 steps found)
- anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
- incomplete reductive TCA cycle (5/7 steps found)
- pyruvate fermentation to propanoate I (5/7 steps found)
- L-carnitine degradation II (2/3 steps found)
- anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
- superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
- reductive TCA cycle II (8/12 steps found)
- formaldehyde assimilation I (serine pathway) (8/13 steps found)
- methylgallate degradation (2/6 steps found)
- protocatechuate degradation I (meta-cleavage pathway) (3/8 steps found)
- L-glutamate degradation VIII (to propanoate) (5/11 steps found)
- superpathway of vanillin and vanillate degradation (3/10 steps found)
- methylaspartate cycle (9/19 steps found)
- syringate degradation (3/12 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of terpenoids and steroids
- Pyruvate metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.1.1.38
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (565 amino acids)
>ECD_01437 malate dehydrogenase, decarboxylating, NAD-requiring; malic enzyme (Escherichia coli BL21) MEPKTKKQRSLYIPYAGPVLLEFPLLNKGSAFSMEERRNFNLLGLLPEVVETIEEQAERA WIQYQGFKTEIDKHIYLRNIQDTNETLFYRLVNNHLDEMMPVIYTPTVGAACERFSEIYR RSRGVFISYQNRHNMDDILQNVPNHNIKVIVVTDGERILGLGDQGIGGMGIPIGKLSLYT ACGGISPAYTLPVVLDVGTNNQQLLNDPLYMGWRNPRITDDEYYEFVDEFIQAVKQRWPD VLLQFEDFAQKNAMPLLNRYRNEICSFNDDIQGTAAVTVGTLIAASRAAGGQLSEKKIVF LGAGSAGCGIAEMIISQTQREGLSEEAARQKVFMVDRFGLLTDKMPNLLPFQTKLVQKRE NLSDWDTDSDVLSLLDVVRNVKPDILIGVSGQTGLFTEEIIREMHKHCPRPIVMPLSNPT SRVEATPQDIIAWTEGNALVATGSPFNPVVWKDKIYPIAQCNNAFIFPGIGLGVIASGAS RITDEMLMSASETLAQYSPLVLNGEGMVLPELKDIQKVSRAIAFAVGKMAQQQGVAVKTS AEALQQAIDDNFWQAEYRDYRRTSI