Protein Info for ECD_01399 in Escherichia coli BL21

Annotation: putative ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 27 to 53 (27 residues), see Phobius details amino acids 86 to 111 (26 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 228 to 253 (26 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 106 to 305 (200 residues), 49.5 bits, see alignment E=2.2e-17

Best Hits

Swiss-Prot: 100% identical to YDCU_ECOLI: Inner membrane ABC transporter permease protein YdcU (ydcU) from Escherichia coli (strain K12)

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to eco:b1442)

MetaCyc: 100% identical to putative ABC transporter membrane subunit YdcU (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>ECD_01399 putative ABC transporter permease (Escherichia coli BL21)
MAMNVLQSPSRPGLGKVSGFFWRNPGLGLFLLLLGPLMWFGIVYFGSLLTLLWQGFYTFD
DFTMSVTPELTLANIRALFNPANYDIILRTLTMAVAVTIASAILAFPMAWYMARYTSGKM
KAFFYIAVMLPMWASYIVKAYAWTLLLAKDGVAQWFLQHLGLEPLLTAFLTLPAVGGNTL
STSGLGRFLVFLYIWLPFMILPVQAALERLPPSLLQASADLGARPRQTFRYVVLPLAIPG
IAAGSIFTFSLTLGDFIVPQLVGPPGYFIGNMVYSQQGAIGNMPMAAAFTLVPIILIALY
LAFVKRLGAFDAL