Protein Info for ECD_01358 in Escherichia coli BL21

Annotation: tyramine oxidase, copper-requiring

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02728: Cu_amine_oxidN3
  • amino acids 31 to 131 (101 residues), 89.4 bits, E=1.6e-29
• PF01179: Cu_amine_oxid
  • amino acids 152 to 565 (414 residues), 428.8 bits, E=2.2e-132

Best Hits

KEGG orthology group: K00276, primary-amine oxidase [EC: 1.4.3.21] (inferred from 100% identity to ebr:ECB_01358)

Predicted SEED Role

"Monoamine oxidase (1.4.3.4)" in subsystem Aromatic Amin Catabolism or Auxin biosynthesis or Glycine and Serine Utilization or Threonine degradation

MetaCyc Pathways

• superpathway of L-threonine metabolism (16/18 steps found)
• L-threonine degradation III (to methylglyoxal) (3/3 steps found)
• phenylethylamine degradation I (2/2 steps found)
• salidroside biosynthesis (2/4 steps found)
• phenylethanol biosynthesis (2/5 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (4/9 steps found)
• aromatic biogenic amine degradation (bacteria) (2/8 steps found)
• superpathway of phenylethylamine degradation (4/11 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glycine, serine and threonine metabolism
• Phenylalanine metabolism
• Tyrosine metabolism
• beta-Alanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.21

Protein Sequence (572 amino acids)

>ECD_01358 tyramine oxidase, copper-requiring (Escherichia coli BL21)
MLDGKHIIEAVVDLQNNKLLSWQPIKDAHGMVLLDDFASVQNIINNSEEFAAAVKKRGIT
DAKKVITTPLTVGYFDGKDGLKQDARLLKVISYLDVGDGNYWAHPIENLVAVVDLEQKKI
VKIEEGPVVPVPMTARPFDGRDRVAPAVKPMQIIEPEGKNYTITGDMIHWRNWDFHLSMN
SRVGPMISTVTYNDNGTKRKVMYEGSLGGMIVPYGDPDIGWYFKAYLDSGDYGMGTLTSP
IARGKDAPSNAVLLNETIADYTGVPMEIPRAIAVFERYAGPEYKHQEMGQPNVSTERREL
VVRWISTVGNYDYIFDWIFHENGTIGIDAGATGIEAVKGVKAKTMHDETAKDDTRYGTLI
DHNIVGTTHQHIYNFRLDLDVDGENNSLVAMDPVVKPNTAGGPRTSTMQVNQYNIGNEQD
AAQKFDPGTIRLLSNPNKENRMGNPVSYQIIPYAGGTHPVAKGAQFAPDEWIYHRLSFMD
KQLWVTRYHPGERFPEGKYPNRSTHDTGLGQYSKDNESLDNTDAVVWMTTGTTHVARAEE
WPIMPTEWVHTLLKPWNFFDETPTLGALKKDN