Protein Info for ECD_01308 in Escherichia coli BL21

Annotation: mechanosensitive channel protein, very small conductance

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 41 to 65 (25 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details PF21088: MS_channel_1st" amino acids 121 to 161 (41 residues), 37.5 bits, see alignment 3.6e-13 PF00924: MS_channel_2nd" amino acids 162 to 229 (68 residues), 80.2 bits, see alignment E=1.9e-26 PF24956: Msl2-3_C" amino acids 236 to 317 (82 residues), 39.6 bits, see alignment E=1e-13 PF21082: MS_channel_3rd" amino acids 237 to 324 (88 residues), 73.8 bits, see alignment E=2.4e-24

Best Hits

Swiss-Prot: 100% identical to YNAI_ECO57: Low conductance mechanosensitive channel YnaI (ynaI) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b1330)

Predicted SEED Role

"Mechanosensitive ion channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>ECD_01308 mechanosensitive channel protein, very small conductance (Escherichia coli BL21)
MIAELFTNNALNLVIIFGSCAALILMSFWFRRGNRKRKGFLFHAVQFLIYTIIISAVGSI
INYVIENYKLKFITPGVIDFICTSLIAVILTIKLFLLINQFEKQQIKKGRDITSARIMSR
IIKITIIVVLVLLYGEHFGMSLSGLLTFGGIGGLAVGMAGKDILSNFFSGIMLYFDRPFS
IGDWIRSPDRNIEGTVAEIGWRITKITTFDNRPLYVPNSLFSSISVENPGRMTNRRITTT
IGLRYEDAAKVGVIVEAVREMLKNHPAIDQRQTLLVYFNQFADSSLNIMVYCFTKTTVWA
EWLAAQQDVYLKIIDIVQSHGADFAFPSQTLYMDNITPPEQGR