Protein Info for ECD_01299 in Escherichia coli BL21

Annotation: UPF0283 family inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 70 to 87 (18 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details TIGR01620: TIGR01620 family protein" amino acids 54 to 341 (288 residues), 498.2 bits, see alignment E=3.6e-154 PF05128: DUF697" amino acids 183 to 341 (159 residues), 187.4 bits, see alignment E=7.9e-60

Best Hits

Swiss-Prot: 100% identical to YCJF_ECOL5: UPF0283 membrane protein YcjF (ycjF) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K08990, putative membrane protein (inferred from 100% identity to eco:b1322)

Predicted SEED Role

"Membrane protein YcjF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>ECD_01299 UPF0283 family inner membrane protein (Escherichia coli BL21)
MTEPLKPRIDFDGPLEVDQNPKFRAQQTFDENQAQNFAPATLDEAQEEEGQVEAVMDAAL
RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV
TEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE
TQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN
RIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG
AGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVKETLQKGKTPSEK