Protein Info for ECD_01296 in Escherichia coli BL21

Annotation: outer membrane porin G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF09381: Porin_OmpG" amino acids 25 to 299 (275 residues), 386.4 bits, see alignment E=1.5e-119 PF04338: DUF481" amino acids 95 to 205 (111 residues), 32.8 bits, see alignment E=1.1e-11

Best Hits

Swiss-Prot: 100% identical to OMPG_ECOLI: Outer membrane porin G (ompG) from Escherichia coli (strain K12)

KEGG orthology group: K14053, outer membrane protein G (inferred from 100% identity to eco:b1319)

MetaCyc: 100% identical to outer membrane porin G (Escherichia coli K-12 substr. MG1655)
RXN0-2542

Predicted SEED Role

"Outer membrane protein G precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>ECD_01296 outer membrane porin G (Escherichia coli BL21)
MKKLLPCTALVMCAGMACAQAEERNDWHFNIGAMYEIENVEGYGEDMDGLAEPSVYFNAA
NGPWRIALAYYQEGPVDYSAGKRGTWFDRPELEVHYQFLENDDFSFGLTGGFRNYGYHYV
DEPGKDTANMQRWKIAPDWDVKLTDDLRFNGWLSMYKFANDLNTTGYADTRVETETGLQY
TFNETVALRVNYYLERGFNMDDSRNNGEFSTQEIRAYLPLTLGNHSVTPYTRIGLDRWSN
WDWQDDIEREGHDFNRVGLFYGYDFQNGLSVSLEYAFEWQDHDEGDSDKFHYAGVGVNYS
F