Protein Info for ECD_01256 in Escherichia coli BL21

Annotation: DUF1049 family inner membrane protein, function unknown

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 45 to 67 (23 residues), see Phobius details PF06305: LapA_dom" amino acids 23 to 85 (63 residues), 74.8 bits, see alignment E=2.1e-25

Best Hits

Swiss-Prot: 100% identical to LAPA_ECOLI: Lipopolysaccharide assembly protein A (lapA) from Escherichia coli (strain K12)

KEGG orthology group: K08992, putative membrane protein (inferred from 100% identity to eco:b1279)

Predicted SEED Role

"Inner membrane protein yciS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (102 amino acids)

>ECD_01256 DUF1049 family inner membrane protein, function unknown (Escherichia coli BL21)
MKYLLIFLLVLAIFVISVTLGAQNDQQVTFNYLLAQGEYRISTLLAVLFAAGFAIGWLIC
GLFWLRVRVSLARAERKIKRLENQLSPATDVAVVPHSSAAKE