Protein Info for ECD_01137 in Escherichia coli BL21

Annotation: repressor of blue light-responsive genes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF13411: MerR_1" amino acids 4 to 71 (68 residues), 66.4 bits, see alignment E=3.9e-22 PF00376: MerR" amino acids 5 to 42 (38 residues), 47.4 bits, see alignment 2.7e-16 PF22270: MlrA_helical" amino acids 81 to 154 (74 residues), 99.1 bits, see alignment E=2.4e-32 PF22267: MlrA_C" amino acids 162 to 238 (77 residues), 111.2 bits, see alignment E=4.9e-36

Best Hits

Swiss-Prot: 99% identical to BLUR_ECOLI: HTH-type transcriptional repressor BluR (bluR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b1162)

Predicted SEED Role

"Putative HTH-type transcriptional regulator ycgE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>ECD_01137 repressor of blue light-responsive genes (Escherichia coli BL21)
MAYYSIGDVAERCGINPVTLRAWQRRYGLLKPQRSEGGHRLFDEEDIQRIEEIKRWISNG
VPVGKVKALLETTSQDTEDDWSRLQEEMMSILRMANPAKLRARIISLGREYPVDQLINHV
YLPVRQRLVLDHNTSRIMSSMFDGALIEYTAASLFEMRRKPGKEAILMAWNVEERARLWL
EAWRLSLSGWHISVLADPIESPRPELFPTQTLIVWTGMAPTRRQNELLQHWGEQGYKVIF
HAP