Protein Info for ECD_01112 in Escherichia coli BL21

Annotation: lipoprotein-releasing system transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 25 to 48 (24 residues), see Phobius details amino acids 268 to 290 (23 residues), see Phobius details amino acids 310 to 336 (27 residues), see Phobius details amino acids 343 to 360 (18 residues), see Phobius details amino acids 366 to 384 (19 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 4 to 399 (396 residues), 491.7 bits, see alignment E=8.9e-152 PF12704: MacB_PCD" amino acids 27 to 212 (186 residues), 52.8 bits, see alignment E=6.6e-18 PF02687: FtsX" amino acids 270 to 392 (123 residues), 62 bits, see alignment E=5.9e-21

Best Hits

Swiss-Prot: 100% identical to LOLC_ECO57: Lipoprotein-releasing system transmembrane protein LolC (lolC) from Escherichia coli O157:H7

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 100% identity to eco:b1116)

MetaCyc: 100% identical to lipoprotein release complex - inner membrane subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>ECD_01112 lipoprotein-releasing system transmembrane protein (Escherichia coli BL21)
MYQPVALFIGLRYMRGRAADRFGRFVSWLSTIGITLGVMALVTVLSVMNGFERELQNNIL
GLMPQAILSSEHGSLNPQQLPETAVKLDGVNRVAPITTGDVVLQSARSVAVGVMLGIDPA
QKDPLTPYLVNVKQTDLEPGKYNVILGEQLASQLGVNRGDQIRVMVPSASQFTPMGRIPS
QRLFNVIGTFAANSEVDGYEMLVNIEDASRLMRYPAGNITGWRLWLDEPLKVDSLSQQKL
PEGSKWQDWRDRKGELFQAVRMEKNMMGLLLSLIVAVAAFNIITSLGLMVMEKQGEVAIL
QTQGLTPRQIMMVFMVQGASAGIIGAILGAALGALLASQLNNLMPIIGVLLDGAALPVAI
EPLQVIVIALVAMAIALLSTLYPSWRAAATQPAEALRYE