Protein Info for ECD_01100 in Escherichia coli BL21

Annotation: uncharacterized protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF07233: DUF1425" amino acids 31 to 124 (94 residues), 92.3 bits, see alignment E=7.6e-31

Best Hits

Swiss-Prot: 98% identical to YCFL_ECOLI: Uncharacterized protein YcfL (ycfL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to sbc:SbBS512_E2219)

Predicted SEED Role

"YcfL protein: an outer membrane lipoprotein that is part of a salvage cluster"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (125 amino acids)

>ECD_01100 uncharacterized protein (Escherichia coli BL21)
MRKGCFGLVSLALLLLVGCRSHPEIPVNDEQSLVMESSLLAAGISAEKPVLSTSDIQPSA
SSTLYNERQEPITVHYRFYWYDARGLEMHPLERPRSVTIPAHSAVTLYGSANFLGAHKVR
LYLYL