Protein Info for ECD_01087 in Escherichia coli BL21

Annotation: 3-oxoacyl-[acyl-carrier-protein] synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 1 to 317 (317 residues), 502.7 bits, see alignment E=2e-155 PF08545: ACP_syn_III" amino acids 106 to 183 (78 residues), 101.9 bits, see alignment E=1.5e-33 PF08541: ACP_syn_III_C" amino acids 228 to 316 (89 residues), 126.9 bits, see alignment E=2.8e-41

Best Hits

Swiss-Prot: 100% identical to FABH_ECOLC: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to eco:b1091)

MetaCyc: 100% identical to 3-oxoacyl-[acyl carrier protein] synthase 3 (Escherichia coli K-12 substr. MG1655)
[Acyl-carrier-protein] S-acetyltransferase. [EC: 2.3.1.38]; Beta-ketoacyl-acyl-carrier-protein synthase III. [EC: 2.3.1.38, 2.3.1.180]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180 or 2.3.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>ECD_01087 3-oxoacyl-[acyl-carrier-protein] synthase III (Escherichia coli BL21)
MYTKIIGTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAQNETVSTMGFEAAT
RAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALS
VADQYVKSGAVKYALVVGSDVLARTCDPTDRGTIIIFGDGAGAAVLAASEEPGIISTHLH
ADGSYGELLTLPNADRVNPENSIHLTMAGNEVFKVAVTELAHIVDETLAANNLDRSQLDW
LVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKPGQLVL
LEAFGGGFTWGSALVRF