Protein Info for ECD_01077 in Escherichia coli BL21

Annotation: flagellar rod assembly protein and murein hydrolase; flagellum-specific muramidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR02541: flagellar rod assembly protein/muramidase FlgJ" amino acids 12 to 295 (284 residues), 438.6 bits, see alignment E=8.1e-136 PF10135: Rod-binding" amino acids 50 to 97 (48 residues), 65.6 bits, see alignment 4.7e-22 PF01832: Glucosaminidase" amino acids 160 to 295 (136 residues), 121.4 bits, see alignment E=3.9e-39

Best Hits

Swiss-Prot: 100% identical to FLGJ_ECOLI: Peptidoglycan hydrolase FlgJ (flgJ) from Escherichia coli (strain K12)

KEGG orthology group: K02395, flagellar protein FlgJ (inferred from 100% identity to eco:b1081)

MetaCyc: 83% identical to flagellar rod assembly protein/beta-N-acetylglucosaminidase (Salmonella enterica enterica serovar Typhimurium str. LT2)
Beta-N-acetylhexosaminidase. [EC: 3.2.1.52]

Predicted SEED Role

"Flagellar protein FlgJ [peptidoglycan hydrolase] (EC 3.2.1.-)" in subsystem Flagellum (EC 3.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-, 3.2.1.52

Use Curated BLAST to search for 3.2.1.- or 3.2.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>ECD_01077 flagellar rod assembly protein and murein hydrolase; flagellum-specific muramidase (Escherichia coli BL21)
MISDSKLLASAAWDAQSLNELKAKAGEDPAANIRPVARQVEGMFVQMMLKSMRDALPKDG
LFSSEHTRLYTSMYDQQIAQQMTAGKGLGLAEMMVKQMTPEQPLPEESTPAAPMKFPLET
VVRYQNQALSQLVQKAVPRNYDDSLPGDSKAFLAQLSLPAQLASQQSGVPHHLILAQAAL
ESGWGQRQIRRENGEPSYNLFGVKASGNWKGPVTEITTTEYENGEAKKVKAKFRVYSSYL
EALSDYVGLLTRNPRYAAVTTAASAEQGAQALQDAGYATDPHYARKLTNMIQQMKSISDK
VSKTYSMNIDNLF