Protein Info for ECD_01067 in Escherichia coli BL21

Annotation: anti-sigma factor for FliA (sigma 28)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 97 TIGR03824: flagellar biosynthesis anti-sigma factor FlgM" amino acids 1 to 90 (90 residues), 72.3 bits, see alignment E=2.4e-24 PF04316: FlgM" amino acids 40 to 88 (49 residues), 37.9 bits, see alignment E=8.3e-14

Best Hits

Swiss-Prot: 100% identical to FLGM_SHIFL: Negative regulator of flagellin synthesis (flgM) from Shigella flexneri

KEGG orthology group: K02398, negative regulator of flagellin synthesis FlgM (inferred from 100% identity to eco:b1071)

Predicted SEED Role

"Negative regulator of flagellin synthesis FlgM" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (97 amino acids)

>ECD_01067 anti-sigma factor for FliA (sigma 28) (Escherichia coli BL21)
MSIDRTSPLKPVSTVQPRETTDAPVTNSRAAKTTASTSTSVTLSDAQAKLMQPGSSDINL
ERVEALKLAIRNGELKMDTGKIADALINEAQQDLQSN