Protein Info for ECD_01065 in Escherichia coli BL21

Annotation: putative lipid II flippase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details amino acids 22 to 22 (1 residues), see Phobius details transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 83 to 110 (28 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details amino acids 236 to 259 (24 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 312 to 334 (23 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details amino acids 408 to 429 (22 residues), see Phobius details amino acids 441 to 466 (26 residues), see Phobius details amino acids 478 to 501 (24 residues), see Phobius details TIGR01695: murein biosynthesis integral membrane protein MurJ" amino acids 2 to 508 (507 residues), 599.4 bits, see alignment E=3e-184 PF03023: MurJ" amino acids 28 to 478 (451 residues), 551.9 bits, see alignment E=5.1e-170

Best Hits

Swiss-Prot: 100% identical to MURJ_ECOLI: Lipid II flippase MurJ (murJ) from Escherichia coli (strain K12)

KEGG orthology group: K03980, virulence factor (inferred from 100% identity to eco:b1069)

MetaCyc: 100% identical to lipid II flippase MurJ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-286

Predicted SEED Role

"Proposed peptidoglycan lipid II flippase MurJ" in subsystem ZZ gjo need homes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>ECD_01065 putative lipid II flippase (Escherichia coli BL21)
MNLLKSLAAVSSMTMFSRVLGFARDAIVARIFGAGMATDAFFVAFKLPNLLRRIFAEGAF
SQAFVPILAEYKSKQGEDATRVFVSYVSGLLTLALAVVTVAGMLAAPWVIMVTAPGFADT
ADKFALTSQLLKITFPYILLISLASLVGAILNTWNRFSIPAFAPTLLNISMIGFALFAAP
YFNPPVLALAWAVTVGGVLQLVYQLPHLKKIGMLVLPRINFHDAGAMRVVKQMGPAILGV
SVSQISLIINTIFASFLASGSVSWMYYADRLMEFPSGVLGVALGTILLPSLSKSFASGNH
DEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFDALMTQRALIAYSVG
LIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLILTQLMNLAFIGPLKHAGLSLSIGLAACL
NASLLYWQLRKQKIFTPQPGWMAFLLRLVVAVLVMSGVLLGMLHIMPEWSLGTMPWRLLR
LMAVVLAGIAAYFAALAVLGFKVKEFARRTV