Protein Info for ECD_01012 in Escherichia coli BL21

Annotation: putative reactive intermediate detoxifying aminoacrylate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR03611: pyrimidine utilization protein D" amino acids 1 to 257 (257 residues), 410.8 bits, see alignment E=1.1e-127 PF00561: Abhydrolase_1" amino acids 14 to 240 (227 residues), 82.4 bits, see alignment E=6.5e-27 PF12146: Hydrolase_4" amino acids 15 to 232 (218 residues), 58.8 bits, see alignment E=7.6e-20 PF12697: Abhydrolase_6" amino acids 16 to 249 (234 residues), 71.6 bits, see alignment E=2.4e-23

Best Hits

Swiss-Prot: 100% identical to RUTD_ECOBR: Putative aminoacrylate hydrolase RutD (rutD) from Escherichia coli (strain B / REL606)

KEGG orthology group: K09023, protein RutD (inferred from 100% identity to eco:b1009)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>ECD_01012 putative reactive intermediate detoxifying aminoacrylate hydrolase (Escherichia coli BL21)
MKLSLSPPPYADAPVVVLISGLGGSGSYWLPQLAVLEQEYQVVCYDQRGTGNNPDTLAED
YSIAQMAAELHQALVAAGIEHYAVVGHALGALVGMQLALDYPASVTVLISVNGWLRINAH
TRRCFQVRERLLYSGGAQAWVEAQPLFLYPADWMAARAPRLEAEDALALAHFQGKNNLLR
RLNALKRADFSHHADRIRCPVQIICASDDLLVPTACSSELHAALPDSQKMVMPYGGHACN
VTDPETFNALLLNGLASLLHHREAAL