Protein Info for ECD_00988 in Escherichia coli BL21

Annotation: putative O-antigen capsule production periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF20616: Caps_syn_GfcC_N" amino acids 22 to 146 (125 residues), 170.4 bits, see alignment E=2.1e-54 PF06251: Caps_syn_GfcC_C" amino acids 159 to 247 (89 residues), 136.7 bits, see alignment E=2.2e-44

Best Hits

Swiss-Prot: 99% identical to GFCC_ECOLI: Uncharacterized protein GfcC (gfcC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b0985)

Predicted SEED Role

"YjbG polysaccharide synthesis-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>ECD_00988 putative O-antigen capsule production periplasmic protein (Escherichia coli BL21)
MNKLQSYFIASVLYVMTPHAFAQGTVTIYLPGEEQTLSVGPVENVVQLVTQPQLRDRLWW
PVALLTDSAAKAKALKDYQHVMAQLASWEAEADDDVAATIKSVRQQLLNLNITGRLPVKL
DPDFVRVDENSNPPLVGDYTLYTVQRPVTITLLGAVSGAGQLPWQAGRSVTDYLQDHPRL
AGADKNNVMVITPEGETVVAPVALWNKRHVEPPPGSQLWLGFSAHVLPEKYADLNDQIVS
VLTQRVPD