Protein Info for ECD_00893 in Escherichia coli BL21

Annotation: leucine-responsive global transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 PF13404: HTH_AsnC-type" amino acids 12 to 53 (42 residues), 70.5 bits, see alignment E=1.2e-23 PF13412: HTH_24" amino acids 12 to 59 (48 residues), 76.8 bits, see alignment E=1.1e-25 PF01037: AsnC_trans_reg" amino acids 78 to 152 (75 residues), 83.3 bits, see alignment E=1.3e-27

Best Hits

Swiss-Prot: 100% identical to LRP_ECOLI: Leucine-responsive regulatory protein (lrp) from Escherichia coli (strain K12)

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 100% identity to eco:b0889)

Predicted SEED Role

"Leucine-responsive regulatory protein, regulator for leucine (or lrp) regulon and high-affinity branched-chain amino acid transport system" in subsystem Branched-Chain Amino Acid Biosynthesis or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>ECD_00893 leucine-responsive global transcriptional regulator (Escherichia coli BL21)
MVDSKKRPGKDLDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFIQG
YTALLNPHYLDASLLVFVEITLNRGAPDVFEQFNTAVQKLEEIQECHLVSGDFDYLLKTR
VPDMSAYRKLLGETLLRLPGVNDTRTYVVMEEVKQSNRLVIKTR