Protein Info for ECD_00859 in Escherichia coli BL21

Annotation: putrescine ABC transporter periplasmic binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01547: SBP_bac_1" amino acids 44 to 304 (261 residues), 72.5 bits, see alignment E=1.3e-23 PF13531: SBP_bac_11" amino acids 45 to 308 (264 residues), 29.2 bits, see alignment E=1.6e-10 PF13416: SBP_bac_8" amino acids 46 to 334 (289 residues), 103.2 bits, see alignment E=4.7e-33 PF13343: SBP_bac_6" amino acids 77 to 321 (245 residues), 76 bits, see alignment E=6.6e-25

Best Hits

Swiss-Prot: 100% identical to POTF_ECOLI: Putrescine-binding periplasmic protein (potF) from Escherichia coli (strain K12)

KEGG orthology group: K11073, putrescine transport system substrate-binding protein (inferred from 100% identity to eco:b0854)

MetaCyc: 100% identical to putrescine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine ABC transporter putrescine-binding protein PotF (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>ECD_00859 putrescine ABC transporter periplasmic binding protein (Escherichia coli BL21)
MTALNKKWLSGLVAGALMAVSVGTLAAEQKTLHIYNWSDYIAPDTVANFEKETGIKVVYD
VFDSNEVLEGKLMAGSTGFDLVVPSASFLERQLTAGVFQPLDKSKLPEWKNLDPELLKLV
AKHDPDNKFAMPYMWATTGIGYNVDKVKAVLGENAPVDSWDLILKPENLEKLKSCGVSFL
DAPEEVFATVLNYLGKDPNSTKADDYTGPATDLLLKLRPNIRYFHSSQYINDLANGDICV
AIGWAGDVWQASNRAKEAKNGVNVSFSIPKEGAMAFFDVFAMPADAKNKDEAYQFLNYLL
RPDVVAHISDHVFYANANKAATPLVSAEVRDNPGIYPPADVRAKLFTLKVQDPKIDRVRT
RAWTKVKSGK