Protein Info for ECD_00831 in Escherichia coli BL21

Annotation: retron EC86 RNA-directed DNA polymerase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF00078: RVT_1" amino acids 54 to 247 (194 residues), 89 bits, see alignment E=1.8e-29

Best Hits

Swiss-Prot: 100% identical to RT86_ECOLX: RNA-directed DNA polymerase from retron EC86 from Escherichia coli

KEGG orthology group: None (inferred from 100% identity to ebr:ECB_00831)

Predicted SEED Role

"Retron-type RNA-directed DNA polymerase (EC 2.7.7.49)" (EC 2.7.7.49)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>ECD_00831 retron EC86 RNA-directed DNA polymerase-like protein (Escherichia coli BL21)
MKSAEYLNTFRLRNLGLPVMNNLHDMSKATRISVETLRLLIYTADFRYRIYTVEKKGPEK
RMRTIYQPSRELKALQGWVLRNILDKLSSSPFSIGFEKHQSILNNATPHIGANFILNIDL
EDFFPSLTANKVFGVFHSLGYNRLISSVLTKICCYKNLLPQGAPSSPKLANLICSKLDYR
IQGYAGSRGLIYTRYADDLTLSAQSMKKVVKARDFLFSIIPSEGLVINSKKTCISGPRSQ
RKVTGLVISQEKVGIGREKYKEIRAKIHHIFCGKSSEIEHVRGWLSFILSVDSKSHRRLI
TYISKLEKKYGKNPLNKAKT