Protein Info for ECD_00782 in Escherichia coli BL21

Annotation: OPG biosynthetic transmembrane phosphoethanolamine transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 transmembrane" amino acids 24 to 54 (31 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details PF00884: Sulfatase" amino acids 217 to 483 (267 residues), 194.1 bits, see alignment E=1.8e-61

Best Hits

Swiss-Prot: 100% identical to OPGE_ECOLI: Phosphoethanolamine transferase OpgE (opgE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0815)

MetaCyc: 100% identical to phosphoethanolamine transferase OpgE (Escherichia coli K-12 substr. MG1655)
RXN-15210

Predicted SEED Role

"FIG00732228: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (527 amino acids)

>ECD_00782 OPG biosynthetic transmembrane phosphoethanolamine transferase (Escherichia coli BL21)
MNLTLKESLVTRSRVFSPWTAFYFLQSLLINLGLGYPFSLLYTAAFTAILLLLWRTLPRV
QKVLVGVSSLVAACYFPFAQAYGAPNFNTLLALHSTNMEESTEILTIFPWYSYLVGLFIF
ALGVIAIRRKKENEKARWNTFDSLCLVFSVATFFVAPVQNLAWGGVFKLKDTGYPVFRFA
KDVIVNNNEVIEEQERMAKLSGMKDTWTVTAVKPKYQTYVVVIGESARRDALGAFGGHWD
NTPFASSVNGLIFADYIAASGSTQKSLGLTLNRVVDGKPQFQDNFVTLANRAGFQTWWFS
NQGQIGEYDTAIASIAKRADEVYFLKEGNFEADKNTKDEALLDMTAQVLAQEHSQPQLIV
LHLMGSHPQACDRTQGKYETFVQSKETSCYLYTMTQTDDLLRKLYDQLRNSGSSFSLVYF
SDHGLAFKERGKDVQYLAHDDKYQQNFQVPFMVISSDDKAHRVIKARRSANDFLGFFSQW
TGIKAKEINIKYPFISEKKAGPIYITNFQLQKVDYNHLGTDIFDPKP