Protein Info for ECD_00781 in Escherichia coli BL21

Annotation: outer membrane protein X

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF06316: Ail_Lom" amino acids 1 to 115 (115 residues), 53.8 bits, see alignment E=2.2e-18 amino acids 126 to 171 (46 residues), 31 bits, see alignment E=2.2e-11 PF13505: OMP_b-brl" amino acids 9 to 171 (163 residues), 86.3 bits, see alignment E=3.1e-28

Best Hits

Swiss-Prot: 100% identical to OMPX_ECO57: Outer membrane protein X (ompX) from Escherichia coli O157:H7

KEGG orthology group: K11934, outer membrane protein X (inferred from 100% identity to eco:b0814)

Predicted SEED Role

"Attachment invasion locus protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>ECD_00781 outer membrane protein X (Escherichia coli BL21)
MKKIACLSALAAVLAFTAGTSVAATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPL
GVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPT
YKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF