Protein Info for ECD_00746 in Escherichia coli BL21

Annotation: exision nuclease of nucleotide excision repair, DNA damage recognition component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 673 TIGR00631: excinuclease ABC subunit B" amino acids 5 to 666 (662 residues), 1111.5 bits, see alignment E=0 PF04851: ResIII" amino acids 13 to 87 (75 residues), 41.3 bits, see alignment E=4.7e-14 PF17757: UvrB_inter" amino acids 159 to 249 (91 residues), 112.2 bits, see alignment E=3.1e-36 PF00271: Helicase_C" amino acids 434 to 545 (112 residues), 72.3 bits, see alignment E=1.1e-23 PF12344: UvrB" amino acids 552 to 593 (42 residues), 75.7 bits, see alignment 5.9e-25 PF02151: UVR" amino acids 634 to 667 (34 residues), 27.5 bits, see alignment (E = 6.2e-10)

Best Hits

Swiss-Prot: 100% identical to UVRB_ECOLI: UvrABC system protein B (uvrB) from Escherichia coli (strain K12)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 100% identity to ecl:EcolC_2864)

MetaCyc: 100% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (673 amino acids)

>ECD_00746 exision nuclease of nucleotide excision repair, DNA damage recognition component (Escherichia coli BL21)
MSKPFKLNSAFKPSGDQPEAIRRLEEGLEDGLAHQTLLGVTGSGKTFTIANVIADLQRPT
MVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYYDYYQPEAYVPSSDTFIEKDASVNEHIE
QMRLSATKAMLERRDVVVVASVSAIYGLGDPDLYLKMMLHLTVGMIIDQRAILRRLAELQ
YARNDQAFQRGTFRVRGEVIDIFPAESDDIALRVELFDEEVERLSLFDPLTGQIVSTIPR
FTIYPKTHYVTPRERIVQAMEEIKEELAARRKVLLENNKLLEEQRLTQRTQFDLEMMNEL
GYCSGIENYSRFLSGRGPGEPPPTLFDYLPADGLLVVDESHVTIPQIGGMYRGDRARKET
LVEYGFRLPSALDNRPLKFEEFEALAPQTIYVSATPGNYELEKSGGDVVDQVVRPTGLLD
PIIEVRPVATQVDDLLSEIRQRAAINERVLVTTLTKRMAEDLTEYLEEHGERVRYLHSDI
DTVERMEIIRDLRLGEFDVLVGINLLREGLDMPEVSLVAILDADKEGFLRSERSLIQTIG
RAARNVNGKAILYGDKITPSMAKAIGETERRREKQQKYNEEHGITPQGLNKKVVDILALG
QNIAKTKAKGRGKSRPIVEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAAQIRD
QLHQLRELFIAAS