Protein Info for ECD_00704 in Escherichia coli BL21

Annotation: nicotinamide riboside transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 22 to 41 (20 residues), see Phobius details amino acids 48 to 65 (18 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 109 to 135 (27 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 211 to 226 (16 residues), see Phobius details TIGR01528: nicotinamide mononucleotide transporter PnuC" amino acids 22 to 231 (210 residues), 248.6 bits, see alignment E=2.1e-78 PF04973: NMN_transporter" amino acids 23 to 226 (204 residues), 165.6 bits, see alignment E=5.6e-53

Best Hits

Swiss-Prot: 100% identical to PNUC_ECOLI: Nicotinamide riboside transporter PnuC (pnuC) from Escherichia coli (strain K12)

KEGG orthology group: K03811, nicotinamide mononucleotide transporter (inferred from 100% identity to eco:b0751)

MetaCyc: 100% identical to nicotinamide riboside transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-481

Predicted SEED Role

"Ribosyl nicotinamide transporter, PnuC-like" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or PnuC-like transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>ECD_00704 nicotinamide riboside transporter (Escherichia coli BL21)
MDFFSVQNILVHIPIGAGGYDLSWIEAVGTIAGLLCIGLASLEKISNYFFGLINVTLFGI
IFFQIQLYASLLLQVFFFAANIYGWYAWSRQTSQNEAELKIRWLPLPKALSWLAVCVVSI
GLMTVFINPVFAFLTRVAVMIMQALGLQVVMPELQPDAFPFWDSCMMVLSIVAMILMTRK
YVENWLLWVIINVISVVIFALQGVYAMSLEYIILTFIALNGSRMWINSARERGSRALSH