Protein Info for ECD_00696 in Escherichia coli BL21

Annotation: acyl-CoA thioester hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 TIGR02799: tol-pal system-associated acyl-CoA thioesterase" amino acids 6 to 130 (125 residues), 172 bits, see alignment E=6.1e-55 TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family" amino acids 9 to 125 (117 residues), 168.7 bits, see alignment E=5.3e-54 PF13279: 4HBT_2" amino acids 15 to 131 (117 residues), 64.6 bits, see alignment E=1.8e-21 PF01643: Acyl-ACP_TE" amino acids 15 to 132 (118 residues), 27.2 bits, see alignment E=4.3e-10 PF03061: 4HBT" amino acids 20 to 103 (84 residues), 64.6 bits, see alignment E=1.3e-21

Best Hits

Swiss-Prot: 100% identical to YBGC_ECOLI: Acyl-CoA thioester hydrolase YbgC (ybgC) from Escherichia coli (strain K12)

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 100% identity to eco:b0736)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (134 amino acids)

>ECD_00696 acyl-CoA thioester hydrolase (Escherichia coli BL21)
MNTTLFRWPVRVYYEDTDAGGVVYHASYVAFYERARTEMLRHHHFSQQALMAERVAFVVR
KMTVEYYAPARLDDMLEIQTEITSMRGTSLVFTQRIVNAENTLLNEAEVLVVCVDPLKMK
PRALPKSIVAEFKQ