Protein Info for ECD_00534 in Escherichia coli BL21

Annotation: periplasmic copper- and silver-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11604: CusF_Ec
  • amino acids 39 to 106 (68 residues), 82 bits, E=1.1e-27

Best Hits

Swiss-Prot: 99% identical to CUSF_ECOLI: Cation efflux system protein CusF (cusF) from Escherichia coli (strain K12)

KEGG orthology group: K07810, Cu(I)/Ag(I) efflux system periplasmic protein CusF (inferred from 99% identity to eco:b0573)

MetaCyc: 99% identical to copper/silver export system periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-90; TRANS-RXN0-280

Predicted SEED Role

"Cation efflux system protein CusF precursor" in subsystem Cobalt-zinc-cadmium resistance

Protein Sequence (110 amino acids)

>ECD_00534 periplasmic copper- and silver-binding protein (Escherichia coli BL21)
MKKALQVAMFSLFTVIGFNAQANEHHHETMSEAQPQVISATGEVKGIDLESKKITIHHDP
IAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ