Protein Info for ECD_00531 in Escherichia coli BL21

Annotation: copper-sensing histidine kinase in two-component regulatory system with CusR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 164 to 180 (17 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details PF21085: CusS" amino acids 8 to 180 (173 residues), 122.5 bits, see alignment E=4.6e-39 TIGR01386: heavy metal sensor kinase" amino acids 9 to 479 (471 residues), 519.9 bits, see alignment E=3.3e-160 PF00672: HAMP" amino acids 210 to 257 (48 residues), 41.6 bits, see alignment 3.2e-14 PF26769: HAMP_PhoQ" amino acids 211 to 256 (46 residues), 29.4 bits, see alignment 1.6e-10 PF00512: HisKA" amino acids 262 to 326 (65 residues), 48.9 bits, see alignment E=1.4e-16 PF02518: HATPase_c" amino acids 371 to 481 (111 residues), 94.9 bits, see alignment E=1e-30

Best Hits

Swiss-Prot: 98% identical to CUSS_ECOLI: Sensor histidine kinase CusS (cusS) from Escherichia coli (strain K12)

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 99% identity to ecw:EcE24377A_0588)

MetaCyc: 98% identical to sensor histidine kinase CusS (Escherichia coli K-12 substr. MG1655)
Protein-histidine pros-kinase. [EC: 2.7.13.1]

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.1 or 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>ECD_00531 copper-sensing histidine kinase in two-component regulatory system with CusR (Escherichia coli BL21)
MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAEQDINDLKEISATLER
VLNHPDETQARRLMTLEDIVSGYSNVLISLADSQGKTVYHSPGAPDIREFTRDAIPDKDA
QGGEVYLLSGPTMMMPGHGHGHMEHSNWRMINLPVGPLVDGKPIYTLYIALSIDFHLHYI
NDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQNITSKDLDVRLDPQTVPIE
LEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLITQTEIALSQSRSQKELEDV
LYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLADEVGKVFDFFEALAEDRGVEL
RFVGDKCQVAGDPLMLRRALSNLLSNALRYTPPSEAIVVRCQTVNHQVQVSVENPGTPIA
PEHLPRLFDRFYRVAPSRQRKGEGSGIGLAIVKSIVVAHKGTVAVTSDARGTRFVIMLPE
RE