Protein Info for ECD_00493 in Escherichia coli BL21

Annotation: DLP12 prophage; multidrug resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 3 to 94 (92 residues), 115.2 bits, see alignment E=8.2e-38

Best Hits

Swiss-Prot: 97% identical to EMRE_ECOLI: Multidrug transporter EmrE (emrE) from Escherichia coli (strain K12)

KEGG orthology group: K03297, small multidrug resistance protein, SMR family (inferred from 100% identity to ebr:ECB_00493)

MetaCyc: 97% identical to DLP12 prophage; multidrug/betaine/choline efflux transporter EmrE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-344; TRANS-RXN0-493; TRANS-RXN0-532; TRANS-RXN0-533; TRANS-RXN0-628

Predicted SEED Role

"Ethidium bromide-methyl viologen resistance protein EmrE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (110 amino acids)

>ECD_00493 DLP12 prophage; multidrug resistance protein (Escherichia coli BL21)
MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAY
GIWSGVGIVLISLLLWGFFGQRLDLPAIIGMMLICAGVLVINLLSRSTPH