Protein Info for ECD_00474 in Escherichia coli BL21
Annotation: UDP-2,3-diacylglucosamine pyrophosphohydrolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to LPXH_SHIF8: UDP-2,3-diacylglucosamine hydrolase (lpxH) from Shigella flexneri serotype 5b (strain 8401)
KEGG orthology group: K03269, UDP-2,3-diacylglucosamine hydrolase [EC: 3.6.1.-] (inferred from 100% identity to ebd:ECBD_3134)MetaCyc: 99% identical to UDP-2,3-diacylglucosamine diphosphatase (Escherichia coli K-12 substr. MG1655)
LIPIDXSYNTHESIS-RXN [EC: 3.6.1.54]
Predicted SEED Role
"UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54)" (EC 3.6.1.54)
MetaCyc Pathways
- superpathway of (Kdo)2-lipid A biosynthesis (17/17 steps found)
- superpathway of Kdo2-lipid A biosynthesis (21/25 steps found)
- lipid IVA biosynthesis (P. gingivalis) (9/9 steps found)
- lipid IVA biosynthesis (E. coli) (6/6 steps found)
- lipid IVA biosynthesis (H. pylori) (6/6 steps found)
- lipid IVA biosynthesis (P. putida) (6/6 steps found)
- lipid IVA biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
- lipid IVA biosynthesis (generic) (6/6 steps found)
- lipid IVA biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 3.6.1.-
Use Curated BLAST to search for 3.6.1.- or 3.6.1.54
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (240 amino acids)
>ECD_00474 UDP-2,3-diacylglucosamine pyrophosphohydrolase (Escherichia coli BL21) MATLFIADLHLCVEEPAITAGFLRFLAGEARKADALYILGDLFEAWIGDDDPNPLHCQMA AAIKAVSDSGVPCYFIHGNRDFLLGKRFARESGMTLLPEEKVLELYGRRVLIMHGDTLCT DDAGYQAFRAKVHKPWLQMLFLALPLFVRKRIAARMRANSKEANSSKSLAIMDVNQNAVV SAMEKHQVQWLIHGHTHRPAVHELIANQQPAFRVVLGAWHTEGSMVKVTADDVELIHFPF