Protein Info for ECD_00398 in Escherichia coli BL21

Annotation: thiamine pyrimidine pyrophosphate hydrolase; HMP-PP phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF00702: Hydrolase" amino acids 3 to 224 (222 residues), 37.1 bits, see alignment E=6.6e-13 PF05116: S6PP" amino acids 4 to 76 (73 residues), 21.7 bits, see alignment E=2e-08 amino acids 145 to 236 (92 residues), 42.2 bits, see alignment E=1.1e-14 TIGR00099: Cof-like hydrolase" amino acids 5 to 258 (254 residues), 209.9 bits, see alignment E=5e-66 TIGR01484: HAD hydrolase, family IIB" amino acids 5 to 229 (225 residues), 156 bits, see alignment E=1.5e-49 PF08282: Hydrolase_3" amino acids 6 to 258 (253 residues), 175.9 bits, see alignment E=1.9e-55

Best Hits

Swiss-Prot: 100% identical to COF_ECO24: HMP-PP phosphatase (cof) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K11938, HMP-PP phosphatase [EC: 3.6.1.-] (inferred from 100% identity to eco:b0446)

MetaCyc: 100% identical to HMP-PP phosphatase (Escherichia coli K-12 substr. MG1655)
3.6.1.-; Pyridoxal phosphatase. [EC: 3.1.3.74]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.1.3.74 or 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>ECD_00398 thiamine pyrimidine pyrophosphate hydrolase; HMP-PP phosphatase (Escherichia coli BL21)
MARLAAFDMDGTLLMPDHHLGEKTLSTLARLRERDITLTFATGRHALEMQHILGALSLDA
YLITGNGTRVHSLEGELLHRDDLPADVAELVLYQQWDTRASMHIFNDDGWFTGKEIPALL
QAFVYSGFRYQIIDVKKMPLGSVTKICFCGDHDDLTRLQIQLYEALGERAHLCFSATDCL
EVLPVGCNKGAALTVLTQHLGLSLRDCMAFGDAMNDREMLGSVGSGFIMGNAMPQLRAEL
PHLPVIGHCRNQAVSHYLTHWLDYPHLPYSPE