Protein Info for ECD_00342 in Escherichia coli BL21

Annotation: nucleoid-associated ssDNA and dsDNA binding protein; competitive inhibitor of RecA function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04381: RdgC
  • amino acids 2 to 300 (299 residues), 419 bits, E=5.4e-130

Best Hits

Swiss-Prot: 100% identical to RDGC_SHIDS: Recombination-associated protein RdgC (rdgC) from Shigella dysenteriae serotype 1 (strain Sd197)

KEGG orthology group: K03554, recombination associated protein RdgC (inferred from 100% identity to eco:b0393)

Predicted SEED Role

"DNA recombination-dependent growth factor C" in subsystem CBSS-562.2.peg.5158 SK3 including or DNA repair, bacterial

Protein Sequence (303 amino acids)

>ECD_00342 nucleoid-associated ssDNA and dsDNA binding protein; competitive inhibitor of RecA function (Escherichia coli BL21)
MLWFKNLMVYRLSREISLRAEEMEKQLASMAFTPCGSQDMAKMGWVPPMGSHSDALTHVA
NGQIVICARKEEKILPSPVIKQALEAKIAKLEAEQARKLKKTEKDSLKDEVLHSLLPRAF
SRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGSLPVVPLSMENPIELTLTEWV
RSGSAAQGFQLLDEAELKSLLEDGGVIRAKKQDLTSEEITNHIEAGKVVTKLALDWQQRI
QFVMCDDGSLKRLKFCDELRDQNEDIDREDFAQRFDADFILMTGELAALIQNLIEGLGGE
AQR