Protein Info for ECD_00315 in Escherichia coli BL21

Annotation: taurine ABC transporter periplasmic binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13379: NMT1_2" amino acids 21 to 235 (215 residues), 74.6 bits, see alignment E=2.3e-24 PF04069: OpuAC" amino acids 24 to 246 (223 residues), 105.8 bits, see alignment E=5.9e-34 TIGR01729: taurine ABC transporter, periplasmic binding protein" amino acids 25 to 320 (296 residues), 534.3 bits, see alignment E=4.6e-165 PF12974: Phosphonate-bd" amino acids 43 to 222 (180 residues), 33.9 bits, see alignment E=4.6e-12 PF09084: NMT1" amino acids 46 to 240 (195 residues), 64.5 bits, see alignment E=2.8e-21

Best Hits

Swiss-Prot: 100% identical to TAUA_ECOLI: Taurine-binding periplasmic protein (tauA) from Escherichia coli (strain K12)

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to eco:b0365)

MetaCyc: 100% identical to taurine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Taurine-binding periplasmic protein TauA" in subsystem Taurine Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>ECD_00315 taurine ABC transporter periplasmic binding protein (Escherichia coli BL21)
MAISSRNTLLAALAFIAFQAQAVNVTVAYQTSAEPAKVAQADNTFAKESGATVDWRKFDS
GASIVRALASGDVQIGNLGSSPLAVAASQQVPIEVFLLASKLGNSEALVVKKTISKPEDL
IGKRIAVPFISTTHYSLLAALKHWGIKPGQVEIVNLQPPAIIAAWQRGDIDGAYVWAPAV
NALEKDGKVLTDSEQVGQWGAPTLDVWVVRKDFAEKHPEVVKAFAKSAIDAQQPYIANPD
AWLKQPENISKLARLSGVPEGDVPGLVKGNTYLTPQQQTAELTGPVNKAIIDTAQFLKEQ
GKVPAVANDYSQYVTSRFVQ