Protein Info for ECD_00287 in Escherichia coli BL21

Annotation: 2-methylcitrate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 TIGR01800: 2-methylcitrate synthase/citrate synthase II" amino acids 21 to 388 (368 residues), 557.5 bits, see alignment E=5.7e-172 PF00285: Citrate_synt" amino acids 22 to 371 (350 residues), 427 bits, see alignment E=3e-132

Best Hits

Swiss-Prot: 100% identical to PRPC_ECOLI: 2-methylcitrate synthase (prpC) from Escherichia coli (strain K12)

KEGG orthology group: K01659, 2-methylcitrate synthase [EC: 2.3.3.5] (inferred from 100% identity to eco:b0333)

MetaCyc: 100% identical to 2-methylcitrate synthase (Escherichia coli K-12 substr. MG1655)
2-methylcitrate synthase. [EC: 2.3.3.5]

Predicted SEED Role

"2-methylcitrate synthase (EC 2.3.3.5)" in subsystem Methylcitrate cycle or Propionate-CoA to Succinate Module (EC 2.3.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>ECD_00287 2-methylcitrate synthase (Escherichia coli BL21)
MSDTTILQNSTHVIKPKKSVALSGVPAGNTALCTVGKSGNDLHYRGYDILDLAEHCEFEE
VAHLLIHGKLPTRDELAAYKTKLKALRGLPANVRTVLEALPAASHPMDVMRTGVSALGCT
LPEKEGHTVSGARDIADKLLASLSSILLYWYHYSHNGERIQPETDDDSIGGHFLHLLHGE
KPSQSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSDMYSAIIGAIGALRGPKHGGANE
VSLEIQQRYETPDEAEADIRKRVENKEVVIGFGHPVYTIADPRHQVIKRVAKQLSQEGGS
LKMYNIADRLETVMWESKKMFPNLDWFSAVSYNMMGVPTEMFTPLFVIARVTGWAAHIIE
QRQDNKIIRPSANYVGPEDRPFVALDKRQ