Protein Info for ECD_00283 in Escherichia coli BL21

Annotation: amino acid exporter for proline, lysine, glutamate, homoserine

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 54 to 79 (26 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 136 to 153 (18 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details PF01810: LysE" amino acids 29 to 219 (191 residues), 201.9 bits, see alignment E=3.8e-64 TIGR00949: homoserine/Threonine efflux protein" amino acids 33 to 215 (183 residues), 237.5 bits, see alignment E=4.3e-75

Best Hits

Swiss-Prot: 99% identical to YAHN_ECOLI: Uncharacterized membrane protein YahN (yahN) from Escherichia coli (strain K12)

KEGG orthology group: K03329, hypothetical protein (inferred from 99% identity to eco:b0328)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>ECD_00283 amino acid exporter for proline, lysine, glutamate, homoserine (Escherichia coli BL21)
MMKLLHLFMDEITMDPLHAVYLTVGLFVITFFNPGANLFVVVQTSLASGRRAGVLTGLGV
ALGDAFYSGLGLFGLATLITQCEEIFSLIRIVGGAYLLWFAWCSMRRQSTPQMSTLQQPI
SAPWYVFFRRGLITDLSNPQTVLFFISIFSVTLNAETPTWARLMAWAGIVLASIIWRVFL
SQAFSLPAVRRAYGRMQRVASRVIGAIIGVFALRLIYEGVTQR