Protein Info for ECD_00263 in Escherichia coli BL21

Annotation: ferridoxin-like LutB family protein; putative electron transport chain YkgEFG component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 TIGR00273: iron-sulfur cluster-binding protein" amino acids 18 to 453 (436 residues), 778.5 bits, see alignment E=8.7e-239 PF02589: LUD_dom" amino acids 72 to 294 (223 residues), 177.5 bits, see alignment E=8.6e-56 PF13183: Fer4_8" amino acids 309 to 376 (68 residues), 52.2 bits, see alignment E=2.5e-17 PF13534: Fer4_17" amino acids 311 to 376 (66 residues), 31.2 bits, see alignment E=9e-11 PF11870: LutB_C" amino acids 386 to 468 (83 residues), 41 bits, see alignment E=7.1e-14

Best Hits

Swiss-Prot: 100% identical to YKGF_ECOLI: Uncharacterized electron transport protein YkgF (ykgF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0307)

MetaCyc: 60% identical to component of an iron-sulfur oxidase linked to L-lactate utilization (Bacillus subtilis subtilis 168)
L-lactate dehydrogenase. [EC: 1.1.1.27]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>ECD_00263 ferridoxin-like LutB family protein; putative electron transport chain YkgEFG component (Escherichia coli BL21)
MSIKTSNTDFKTRIRQQIEDPIMRKAVANAQQRIGANRQKMVDELGHWEEWRDRAAQIRD
HVLSNLDAYLYQLSEKVTQNGGHVYFARTKEDATRYILQVAQRKNARKVVKSKSMVTEEI
GVNHVLQDAGIQVIETDLGEYILQLDQDPPSHVVVPAIHKDRHQIRRVLHERLGYEGPET
PEAMTLFIRQKIREDFLSAEIGITGCNFAVAETGSVCLVTNEGNARMCTTLPKTHIAVMG
MERIAPTFAEVDVLITMLARSAVGARLTGYNTWLTGPREAGHVDGPEEFHLVIVDNGRSE
VLASEFRDVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGPIGAVISPLLGGYKDFKDLPY
ACSLCTACDNVCPVRIPLSKLILRHRRVMAEKGITAKAEQRAIKMFAYANSHPGLWKVGM
MAGAHAASWFINGGKTPLKFGAISDWMEARDLPEADGESFRSWFKKHQAQEKKNG