Protein Info for ECD_00149 in Escherichia coli BL21

Annotation: ferrichrome outer membrane transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 747 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF07715: Plug" amino acids 76 to 180 (105 residues), 80.9 bits, see alignment E=9.4e-27 TIGR01783: TonB-dependent siderophore receptor" amino acids 78 to 747 (670 residues), 685.9 bits, see alignment E=3.2e-210 PF00593: TonB_dep_Rec_b-barrel" amino acids 254 to 716 (463 residues), 219.7 bits, see alignment E=1.5e-68

Best Hits

Swiss-Prot: 100% identical to FHUA_ECOLI: Ferrichrome outer membrane transporter/phage receptor (fhuA) from Escherichia coli (strain K12)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to eco:b0150)

MetaCyc: 100% identical to ferrichrome outer membrane transporter/phage receptor (Escherichia coli K-12 substr. MG1655)
RXN0-1701

Predicted SEED Role

"Ferric hydroxamate outer membrane receptor FhuA" in subsystem Iron acquisition in Vibrio or Siderophore Aerobactin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (747 amino acids)

>ECD_00149 ferrichrome outer membrane transporter (Escherichia coli BL21)
MARSKTAQPKHSLRKIAVVVATAVSGMSVYAQAAVEPKEDTITVTAAPAPQESAWGPAAT
IAARQSATGTKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALSYTPGVSVGTRGASNTY
DHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAAIDPYMLERAEIMRGPVSVLYGKSSPGG
LLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDFSDALDDDGVYSYRLTGLARSANAQQKG
SEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPETGYYGWLPKEGTVEPLPNGKRLPTDFN
EGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKTSQNSVYGYGVCSDPANAYSK
QCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFATGDIDHTLLTGVDFMRMRNDI
NAWFGYDDSVPLLNLYNPVNTDFDFNAKDPANSGPYRILNKQKQTGVYVQDQAQWDKVLV
TLGGRYDWADQESLNRVAGTTDKRDDKQFTWRGGVNYLFDNGVTPYFSYSESFEPSSQVG
KDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAVYNLTKTNNLMADPEGSFFSVEGGEIRA
RGVEIEAKAALSASVNVVGSYTYTDAEYTTDTTYKGNTPAQVPKHMASLWADYTFFDGPL
SGLTLGTGGRYTGSSYGDPANSFKVGSYTVVDALVRYDLARVGMAGSNVALHVNNLFDRE
YVASCFNTYGCFWGAERQVVATATFRF