Protein Info for DZA65_RS22695 in Dickeya dianthicola ME23

Annotation: tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 PF10396: TrmE_N" amino acids 6 to 120 (115 residues), 127.7 bits, see alignment E=5.5e-41 TIGR00450: tRNA modification GTPase TrmE" amino acids 11 to 454 (444 residues), 327.7 bits, see alignment E=1.4e-101 PF12631: MnmE_helical" amino acids 123 to 451 (329 residues), 213.4 bits, see alignment E=8.6e-67 TIGR00231: small GTP-binding protein domain" amino acids 216 to 370 (155 residues), 75.5 bits, see alignment E=4.3e-25 PF01926: MMR_HSR1" amino acids 218 to 314 (97 residues), 89.9 bits, see alignment E=2.5e-29 PF02421: FeoB_N" amino acids 218 to 305 (88 residues), 29.2 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 90% identical to MNME_YERE8: tRNA modification GTPase MnmE (mnmE) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 98% identity to ddc:Dd586_4212)

MetaCyc: 88% identical to 5-carboxymethylaminomethyluridine-tRNA synthase GTPase subunit (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y737 at UniProt or InterPro

Protein Sequence (454 amino acids)

>DZA65_RS22695 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE (Dickeya dianthicola ME23)
MSHTDTIVAQATPPGRGGVGILRISGQQASAVAQAVLGKLPKPRYADYLPFHDADGSVLD
QGIALWFPGPNSFTGEDVLELQGHGGPVILDLLLKRVVALPDVRIARPGEFSERAFLNDK
MDLAQAEAIADLIDASSEQAARSAVNSLQGVFSSRVHQLVEALTHLRIYVEAAIDFPDEE
IDFLSDGKIEAMLNEVIGDLEAVRGEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGRD
AAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLREAGDEVERIGIERAWQEIEQADRVL
FMVDGTTTDAVEPAAIWPEFMARLPSRLPITVVRNKADVTGEPLGIEEVNTYSLIRLSAR
TGDGVDLLRDHLKQSMGFTSNTEGGFLARRRHLQALEQAAQHLQQGHEQLVGAYAGELLA
EELRLAQQALSEITGEFTSDDLLGRIFSSFCIGK