Protein Info for DZA65_RS22660 in Dickeya dianthicola ME23

Annotation: helix-turn-helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 88 to 116 (29 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 8 to 173 (166 residues), 37.8 bits, see alignment E=2.7e-13 PF12833: HTH_18" amino acids 235 to 313 (79 residues), 75.6 bits, see alignment E=4.8e-25

Best Hits

KEGG orthology group: None (inferred from 97% identity to dze:Dd1591_4236)

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CSI3 at UniProt or InterPro

Protein Sequence (325 amino acids)

>DZA65_RS22660 helix-turn-helix domain-containing protein (Dickeya dianthicola ME23)
MSKPIPSVAVVACDQFSPFHLSVPCMIFGDVLPGQSLFRLRLCAGEDGVLRSAQGLQVDT
PFGLDTLAQADIVVVPYWRNPQEMPNPALLAALAAAYARGSLLVGLCLGTYVLAWAGLLT
QRNAATHWEFAQDFQQRFPDVRLDTQALYVEDERLLTSAGTAAGLDCCLHLVRKYHGSVI
ANKIARRMVIPPHREGGQAQFIERPMPASTQDTRINALLDYLRSRLDQPHQLDELARRTL
MSRRTFTRQFHKATGMSVGEWLMAERLQQSQTLLESTTLSIEAIAGQVGFSTAASLRQHF
RRQFNVTPGEWRRTFLGGNSLSGFR