Protein Info for DZA65_RS22645 in Dickeya dianthicola ME23

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF13673: Acetyltransf_10" amino acids 38 to 136 (99 residues), 33.4 bits, see alignment E=6.1e-12 PF00583: Acetyltransf_1" amino acids 42 to 136 (95 residues), 77 bits, see alignment E=2.3e-25 PF13508: Acetyltransf_7" amino acids 53 to 136 (84 residues), 47.9 bits, see alignment E=2.2e-16

Best Hits

Swiss-Prot: 42% identical to SAT2_PIG: Diamine acetyltransferase 2 (SAT2) from Sus scrofa

KEGG orthology group: None (inferred from 98% identity to dze:Dd1591_4231)

Predicted SEED Role

"Diamine acetyltransferase (EC 2.3.1.57)" (EC 2.3.1.57)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DS77 at UniProt or InterPro

Protein Sequence (162 amino acids)

>DZA65_RS22645 GNAT family N-acetyltransferase (Dickeya dianthicola ME23)
MTLHIRWAAQQDSATILNFIRELAEYEKALHEVKTNQQEIEQTLFGEGASTEALICEWNG
EPIGFAVFFTSYSTWLGRNGIYLEDLYVSPHYRGYGAGKALLKYIARLAVERGCGRLEWS
VLDWNQPAIDFYDSLGAAPQNEWIRYRLESDSLRQAAENARQ