Protein Info for DZA65_RS22640 in Dickeya dianthicola ME23

Annotation: 4-amino-4-deoxy-L-arabinose-phospho-UDP flippase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 38 to 65 (28 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details

Best Hits

Swiss-Prot: 53% identical to ARNF_ENT38: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF) from Enterobacter sp. (strain 638)

KEGG orthology group: K12963, undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnF (inferred from 96% identity to ddc:Dd586_4202)

MetaCyc: 42% identical to undecaprenyl-phosphate-alpha-L-Ara4N flippase - ArnF subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-276

Predicted SEED Role

"Polymyxin resistance protein PmrM" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance )

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D553 at UniProt or InterPro

Protein Sequence (132 amino acids)

>DZA65_RS22640 4-amino-4-deoxy-L-arabinose-phospho-UDP flippase (Dickeya dianthicola ME23)
MKGYGWALLSVLLVSAAQLSMKWGMSQLPSLTEPLPFMFAMLVLPVAAAAVLVGLAAYAF
SMLSWFNALRFLPLSRAYPLLSLSYVLVWGLAVALPIFPDTFSTGKLLAIALIIAGVWLV
CSRQASRLGDES