Protein Info for DZA65_RS22560 in Dickeya dianthicola ME23

Annotation: phosphate signaling complex protein PhoU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 TIGR02135: phosphate transport system regulatory protein PhoU" amino acids 13 to 221 (209 residues), 244.1 bits, see alignment E=5.7e-77 PF01895: PhoU" amino acids 26 to 111 (86 residues), 85.5 bits, see alignment E=1.3e-28 amino acids 128 to 212 (85 residues), 75.5 bits, see alignment E=1.7e-25

Best Hits

Swiss-Prot: 91% identical to PHOU_SERMA: Phosphate-specific transport system accessory protein PhoU (phoU) from Serratia marcescens

KEGG orthology group: K02039, phosphate transport system protein (inferred from 97% identity to ddc:Dd586_4187)

Predicted SEED Role

"Phosphate transport system regulatory protein PhoU" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CT55 at UniProt or InterPro

Protein Sequence (243 amino acids)

>DZA65_RS22560 phosphate signaling complex protein PhoU (Dickeya dianthicola ME23)
MENLNLNKHISGQFNAELESIRTQVMTMGGLVEQQLTDAITAMHNQDAELAQRVIEGDAK
VNMMEVSIDEACVRIIAKRQPTASDLRLVMAIIKTISELERIGDVADKICRTALEKFSHQ
HQPLLVSLESMGNHTVQMLHDVLDAFARMDLDEAKRIYMEDKKVDKEYEGVVRQLMTHMM
EDPRTIPSVLTALFCARSIERIGDRCQNICEFIFYFVKGQDFRHLGGDALEKMLAQKDAE
KPE