Protein Info for DZA65_RS22545 in Dickeya dianthicola ME23

Annotation: phosphate ABC transporter permease PstC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 75 to 100 (26 residues), see Phobius details amino acids 112 to 139 (28 residues), see Phobius details amino acids 162 to 186 (25 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 286 to 309 (24 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 19 to 311 (293 residues), 305.4 bits, see alignment E=1.7e-95 PF00528: BPD_transp_1" amino acids 96 to 302 (207 residues), 52.3 bits, see alignment E=3e-18

Best Hits

Swiss-Prot: 86% identical to PSTC_ECO57: Phosphate transport system permease protein PstC (pstC) from Escherichia coli O157:H7

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 98% identity to ddc:Dd586_4184)

MetaCyc: 86% identical to phosphate ABC transporter membrane subunit PstC (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CSK6 at UniProt or InterPro

Protein Sequence (319 amino acids)

>DZA65_RS22545 phosphate ABC transporter permease PstC (Dickeya dianthicola ME23)
MAEHKPTITPPGKQGDILFGALVRLAALLTLLLLGGIIVSLIFASWPSIKTFGFSFLWTK
EWDAPAGQFGALVPIYGTIVTSLIALIIAIPISFGIALFLTELAPGWLKRPLGVAIELLA
AIPSIVYGMWGLFVFAPLFARYFQQPVGNVFSSIPLVGTLFSGPAFGIGILAAGVILAIM
IIPYIAAVMRDVFEQTPVMMKESAYGIGCTTWEVIWHIVLPFTKNGVIGGVMLGLGRALG
ETMAVTFIIGNTYQLDSLSLYMPGNSITSALANEFAEADTGLHTAALMELGLILFVITFI
VLACSKLMIMRLAKNEGAR