Protein Info for DZA65_RS22505 in Dickeya dianthicola ME23

Annotation: hotdog family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 transmembrane" amino acids 55 to 72 (18 residues), see Phobius details PF07977: FabA" amino acids 11 to 134 (124 residues), 24.7 bits, see alignment E=8.3e-10

Best Hits

KEGG orthology group: None (inferred from 84% identity to ddc:Dd586_4179)

Predicted SEED Role

"3-hydroxydecanoyl-[ACP] dehydratase (EC 4.2.1.60)" (EC 4.2.1.60)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.60

Use Curated BLAST to search for 4.2.1.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CW15 at UniProt or InterPro

Protein Sequence (157 amino acids)

>DZA65_RS22505 hotdog family protein (Dickeya dianthicola ME23)
MSGYCSADHYLPHQSPMVMVEDVVHVDQNSACCRVQVSPGSVLGPFLDAEGNLPAWFGIE
IIAQTVGVWAGWHQRRHQDEKPRPGMLLGGRGYRCQQDIFPAGSLLEVNVTLLMRDDKIG
SFDGEILIAGEVFASGRLNTYQPDETELQRLLQQEND