Protein Info for DZA65_RS22490 in Dickeya dianthicola ME23

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 772 signal peptide" amino acids 1 to 46 (46 residues), see Phobius details transmembrane" amino acids 261 to 280 (20 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details amino acids 382 to 404 (23 residues), see Phobius details amino acids 431 to 451 (21 residues), see Phobius details amino acids 633 to 654 (22 residues), see Phobius details amino acids 661 to 682 (22 residues), see Phobius details amino acids 688 to 707 (20 residues), see Phobius details amino acids 719 to 738 (20 residues), see Phobius details amino acids 744 to 766 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 89% identity to ddc:Dd586_4176)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CY66 at UniProt or InterPro

Protein Sequence (772 amino acids)

>DZA65_RS22490 hypothetical protein (Dickeya dianthicola ME23)
MMSRPDSFSDWHRRAAITWGAFIVLLLLALALLWPQSRINSSVLALLPGQSMGNAPPELQ
QGFMQRLDRQMVWLVTAGEQADPAVAERWLQQLRSLPELKQVNGPVDAQQQQAWGRFAFE
HRNGLIDHATRQRLQQGGDAQADWVLSQLYSAFAGVSGMELTHDPLLLVRGSQLALQQQA
SQMGLTQGWLTVRDKEGRTWYFLHGELPGGSAFDMTAGRQLVEKLARFQGELRTAFPQSQ
VLTRSTLLFSDYASQQARHDVSTLGAVTVAGVLLLVFLVFRSARPLALCALSVAVGALAG
TVCTLLLFGEIHLMTLVMSLSIVGISADYTLYYLTERMVHGGVASPLDSLRKVLPALLLA
LVTTVAAYLIIVLAPFPGLRQLSVFAASGLTASCLTVIAWYPFLVRGLPVRPIPAMALMG
RWLAAWRRNVRVRWGIPGLVLIVGVIGVSRIDVNDDIAQLQSLPPSLVQQERQISALTGQ
QADQTWFMVYGDSPEQTLQRLEQLTPALDAARQKRYFASYRLLPLNSLQRQQRDAQLIAG
AAPVVMSRLHDAGVNLGEPDIRPMTATPEAWLNGPLSEGWRLLWLTLPNGASGVLVPVNG
VRDGGRLEKLSQDLPGVVWIDRKSTFDQLFGRYRMILGSLLAVAVGVIALSYVLRLGIRR
GLLSVVPSVLSLLGSVAVLAFSGHPFNLFSLLALVLVLGIGINYTLFFGNPRGTPMTSLL
AVTLAMCTTLLTLGMLVFSSTQAISSFGIVLCAGIFIAFLLAPLALPDSKGK