Protein Info for DZA65_RS22420 in Dickeya dianthicola ME23

Annotation: bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR01173: UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase" amino acids 6 to 455 (450 residues), 671 bits, see alignment E=4.2e-206 PF01128: IspD" amino acids 6 to 126 (121 residues), 34 bits, see alignment E=9.6e-12 PF12804: NTP_transf_3" amino acids 8 to 120 (113 residues), 74 bits, see alignment E=5.7e-24 PF00483: NTP_transferase" amino acids 8 to 210 (203 residues), 49.3 bits, see alignment E=1.7e-16 PF00132: Hexapep" amino acids 268 to 300 (33 residues), 32.1 bits, see alignment (E = 2.2e-11) amino acids 395 to 429 (35 residues), 33.6 bits, see alignment 7.7e-12 PF25087: GMPPB_C" amino acids 269 to 352 (84 residues), 44.6 bits, see alignment E=3.8e-15 PF14602: Hexapep_2" amino acids 395 to 429 (35 residues), 27.3 bits, see alignment 8.6e-10

Best Hits

Swiss-Prot: 81% identical to GLMU_PECCP: Bifunctional protein GlmU (glmU) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K04042, bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC: 2.3.1.157 2.7.7.23] (inferred from 96% identity to ddd:Dda3937_00142)

MetaCyc: 77% identical to fused N-acetylglucosamine-1-phosphate uridyltransferase and glucosamine-1-phosphate acetyltransferase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylglucosamine diphosphorylase. [EC: 2.7.7.23]; Glucosamine-1-phosphate N-acetyltransferase. [EC: 2.7.7.23, 2.3.1.157]

Predicted SEED Role

"N-acetylglucosamine-1-phosphate uridyltransferase (EC 2.7.7.23) / Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)" in subsystem Peptidoglycan Biosynthesis or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.3.1.157, EC 2.7.7.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.157 or 2.7.7.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CY74 at UniProt or InterPro

Protein Sequence (456 amino acids)

>DZA65_RS22420 bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU (Dickeya dianthicola ME23)
MSNSAMSVVILAAGKGTRMYSDLPKVLHPLAGKPIVQHVIDAAMDVGARRIHLVYGHGAD
LIRETLTETSLNWVLQAEQLGTGHAVQQAADGFDDNEDILILYGDVPLISPETLQGLVAA
KPQGGIGLLTVNLADPSGYGRIVRHNGEVVGIVEHKDATEQQRAISEINTGILVAGGRDL
KRWLSQLNNHNVQGEYYLTDIIAMASQEGQRVAAVQPSRLSEVEGINNRLQLATLERTYQ
REQAEQLLLAGVMLLDPARFDLRGELTHGRDVTIDANVILEGRVTLGNRVKIGAGCVIKN
SVIGDDCELSPYTVVENAALEARCTVGPFARLRPGAVLEEDAHVGNFVELKKARLGKGSK
AGHLTYLGDADIGAGVNIGAGVITCNYDGANKHQTVIGDDVFVGSDSQLIAPVKVANGAT
IGAGTTVTRNVSENELVIGRVKQTHITGWKRPVKKK